SlideShare uma empresa Scribd logo
1 de 50
Baixar para ler offline
Aug/26/2019
Deep Learning based
Drug Discovery
Bonggun Shin
1
Aug/26/2019
/50
Outline
• Problem definition

• Drug discovery process

• Drug target interaction (DTI)

• Background

• Sequence data in DTI

• Recent trends in word embeddings

• Previous SOTA in DTI

• Molecule transformer
!2
Aug/26/2019
/50
Drug Discovery Process
Target
Identification
Molecule
Discovery
Molecule
Optimization
Clinical
Test
FDA
Approval
Repurposing Generating
• Green - Physical or computer based (in-silico) experiments

• Yellow - Animal and human experiments
!3
Aug/26/2019
/50
Drug Repurposing
• Safe - already approved drugs

• Cheap - no need to come up with a new molecule
Allarakhia, Minna. "Open-source approaches for the repurposing of existing or failed candidate drugs: learning from
and applying the lessons across diseases." Drug design, development and therapy 7 (2013): 753
!4
Aug/26/2019
/50
Drug Target Interaction
• Input: 

• Drug - molecule

• Target - protein (biomarker)

• Output: Interaction (affinity score)

• Example: EGFR protein (cancer biomarker) has high affinity scores
with Lapatinib (anti-cancer drug)

• If other non anti-cancer drugs has high affinity scores with EGFR,
they can be candidates of an anti-cancer drug

!5
Aug/26/2019
/50
Inputs of DTI
• Sequence

• Molecule (SMILES format)

• Lapatinib: "CS(=O)(=O)CCNCC1=CC=C(O1)C2…"

• protein (FASTA format)

• EGFR: "MRPSGTAGAALLALLAALCPASRALE…"
!6
Aug/26/2019
/50
Sequence Representation
• Sequence: SMILES, FASTA, and text

• Vector representation

• One hot vector

• (word/character) Embedding - more information
• Once represented as a vector, we can apply many deep
learning methods
!7
Aug/26/2019
/50
Recent trends in word
embeddings
• Local contextual embeddings: Word2vec [1] 

• RNN based contextual embeddings: ELMO [2]

• Attention (w/o RNN) based contextual embeddings:
Transformer [3]

• The (current) final boss: BERT [4] 

(Transformer+Masked LM)
[1] Mikolov, Tomas, et al. "Distributed representations of words and phrases and their compositionality." NIPS 2013.
[2] Peters, Matthew E., et al. "Deep contextualized word representations." NAACL (2018).
[3] Vaswani, Ashish, et al. "Attention is all you need." Advances in Neural Information Processing Systems. 2017.
[4] Devlin, Jacob, et al. "Bert: Pre-training of deep bidirectional transformers for language understanding." arXiv preprint arXiv:1810.04805 (2018).!8
Aug/26/2019
/50
Word2Vec
• Word representation: Word -> Vector

• W2V: local context words when calculating a representation vector
for a target word

• EX) When inferring the red word, 4 context words (blues) are
used
!9
Aug/26/2019
/50
Word2Vec
• How to train word2vec

• Example sentence: 

I go to Emory University located in Atlanta.

• input - context words

• "I", "go", "Emory" "University"

• output - target word, "to"
!10
Aug/26/2019
/50
ELMO
• Concats of independently trained left-to-right and right- to-
left LSTM 

• It considers all words in a sentence to represent a word

• Long sequence -> information vanishing problem
!11
Aug/26/2019
/50
How to train ELMO
• For the simplicity I assume word level embeddings (but actually they use character
level embeddings)

• How to train word2vec

• Example sentence: 

I go to Emory University located in Atlanta.

• Input

• left-to-right model: "I", "go"

• right-to-left model: "Atlanta", "in" "located" "University", "Emory"

• Output

• "to"
!12
Aug/26/2019
/50
Transformer
• Calculating a vector for a word using all words in the sentence

• Attention is all you need!

• replaces Embedding+RNN with the transformer (self-attention)
!13
Aug/26/2019
/50
Transformer
• Model for machine translation

• Trained (sub) model can be used as word representation
model
* All transformer figures in this slide are from http://jalammar.github.io/illustrated-transformer/
!14
Aug/26/2019
/50
Encoder-Decoder
!15
Aug/26/2019
/50
Encoder
• Encoder can be stacked on top of each other (sequence length is preserved)

• Input words are transformed into randomly initialized vectors, x_i

• Encoder consists of two parts; self-attention and feed forward
!16
Aug/26/2019
/50
Self-Attention
High level explanation
• The vector for the token "it_" can be calculated as weighted
sum (Attention) of all tokens in the same sentence (Self).
!17
Aug/26/2019
/50
Weighted Sum
• Get three helper vectors

• For a given token, calculate
the scores of all other tokens 

• Normalize those scores to get
weights

• Weighted sum
!18
Aug/26/2019
/50
Three (Helper) Vectors
• Query, Key, and Value vector are used when calculating hidden representations

• These helper vectors are just a projection from trainable params Wq, Wk, and Wv
!19
Aug/26/2019
/50
Scoring
• Calculate scores for each word with respect to token "Thinking" using (query, key)

• For example: "Thinking": 112, "Machines: "96"

• Repeat this for all other tokens

• The vector, values, will be used in the next step
!20
Aug/26/2019
/50
Self-Attentions
• Divide by 8

• The square root of
the dimension of the
key vectors (paper
used dim=64)

• Softmax: Normalize
scores to be sum to
one

• Hidden representation
is a weighted sum of
value vectors
!21
Aug/26/2019
/50
Multi-Heads
• Multi filters in CNN, Multi heads in Transformer

• 8 Heads: 8 sets of trainable params Wq, Wk, and Wv, 8 sets of z1 and z2

• Expecting different heads to learn different aspects
!22
Aug/26/2019
/50
FeedForward
This is the output of the one encoding layer
(R)
!23
Aug/26/2019
/50
Positional Encoding
• Why PE? - Need to distinguish "I am a student" vs "am student I a"

• Special patterns representing order of words
!24
Aug/26/2019
/50
BERT
• Google AI Language Team

• 10 month ago

• 1100+ citations

• SOTA on eleven natural language processing tasks

• Outperforms human on SQuaD task

• Transformer + New language model task
!25
Aug/26/2019
/50
Overview
• Based on the Transformers

• Two new tasks

• Modified input representation
Transformer
Transformer
Transformer
MaskedLM IsNext
!26
Aug/26/2019
/50
Input Representation
• Segment Embedding (0:first sentence, 1:second sentence)

• Position Embedding (same as Transformer)
used for classification tasks sentence separator
* Adopted from the BERT paper
!27
Aug/26/2019
/50
Masked LM Task
• Given some "masked tokens" in a sentence, the task is to predict the original tokens

• Original: I am a student

• Input: I [MASK] a student, location (1)

• Output: am

• Downsides of this

• [MASK] token is never seen during fine-tuning

• 80% [MASK], 10% random token, 10% no change

• 15% of [MASK] -> should be slow to learn a general language model

• 4 days of TPU (v2-128) (worth of $10,000 google cloud credits)
!28
Aug/26/2019
/50
IsNext Task
• Input consists of two sentences

• Original: I am a student / I go to Emory

• Input: [CLS] I [MASK] a student [SEP] I go [MASK]
Emory [SEP], (masked token location, "2", "8")

• Output of MaskedLM: 

"am", "to"

• Output of IsNext: 

1 (2nd one is the next sentence of 1st one)
!29
Aug/26/2019
/50
Model Config
• Base

• Hidden-dim: 768 

• A-Head: 12

• Layer: 12

• 110M parameters
• Large

• Hidden-dim: 1024 

• A-Head: 16

• Layer: 24

• 340M parameters
!30
Aug/26/2019
/50
Finetuning (1/4)
Sentence Pair Classification
• MRPC

• One sentence is a
paraphrased one of the
other

• Task is to predict if given
two sentences are
semantically equivalent

• X: ("I go to Emory", 

"I am an Emory student")

• Y: yes (equivalent)
* From the BERT paper
!31
Aug/26/2019
/50
Finetuning (2/4)
Single Sentence Classification
• SST

• Movie review

• X: This movie is fun

• Y: positive
* From the BERT paper
!32
Aug/26/2019
/50
Finetuning (3/4)
Question Answering
• SQuAD

• Given question and
paragraph pairs, the task is to
select a word/phrases that
could answer the given
question 

• X: (Q: "Where is Emory?", P:
"Emory University is
a private research university in
the Druid Hills neighborhood
of the city of Atlanta,
Georgia, United States")

• Y: (Druid, States)
* From the BERT paper
!33
Aug/26/2019
/50
Finetuning (4/4)
Single Sentence Tagging (NER)
• Named Entity Recognition (NER)

• Named entity?

• Organization (Emory)

• People (Bill Gates)

• Location (Atlanta) …

• Given a sentence the task is to tag
each word if it indicates a certain
named entity 

• X: "Dr. Xiong is a professor at
Emory"

• Y: B-PER I-PER O O O O B-ORG
* From the BERT paper
!34
Aug/26/2019
/50
DeepDTA
• DeepDTA: Deep drug target
affinity

• Previous SOTA in DTI

• Bioinformatics (IF=5.481)

• Task: predicting affinity scores

• One-hot
embedding+CNN+Dense
Drug
Vector
Target
Vector
CNN
Regression
CNN
FFNN
!35
Aug/26/2019
/50
Convolution Operation
CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl
5
!36
Aug/26/2019
/50
Convolution Operation
CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl
35
!37
Aug/26/2019
/50
Convolution Operation
CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl
35 8
!38
Aug/26/2019
/50
Convolution Operation
CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl
35 8 2XX X XX XXX X XX XX X XX XX X XX
!39
Aug/26/2019
/50
Convolution Operation
CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl
35 8 2XX X XX XXX X XX XX X XX XX X XX
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV…APQSSEFIGA
YY Y YYY Y YY YY YY YY…YY Y YY Y YY Y
Drug
Vector
Target
Vector
CNN
Regression
CNN
FFNN
!40
Aug/26/2019
/50
Limitations of CNN
• F and Cl will be convolved together: but they are actually in long distance

• Cl will never be convolved with N: but they are closer than F

• Local context (CNN) -> global context (self-attention)
CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl
!41
Aug/26/2019
/50
Molecule Transformer
• BERT based sequence representation

• Pre-training: only masked LM 

• Special tokens - [CLS] [MASK] [SEP] vs [REP] [MASK] [BEGIN] [END]
!42
Aug/26/2019
/50
Special Tokens
• [REP]: same as [CLS]

• [BEGIN]/[END]: indicates truncation of long sequence (>100)

• length<100: [REP] [BEGIN] C N = C = O [END] 

• length>100: [REP] C C = ( N == C) Cl … O = C
!43
Aug/26/2019
/50
Pre-train
• PubChem database 

• 97,092,853 molecule 

• Parameters: layers 8, heads
8, and hidden vector size 128 

• 8-core TPU machine, the
pre-training took about 58
hours. 

• Masked LM task result:
0.9727 

(BERT was 0.9855)
MT-DTI
We choose 15% of SMILES tokens at random for each molecule sequence, and
he chosen token with one of the special tokens, [MASK] with the probability of 0.8.
other 20% of the time, we replace the chosen token with a random SMILES token2
rve the chosen token, with an equal probability, respectively. The target label of
is the chosen token with the index. For example, one possible prediction task for
socyanate (CN=C=O) is
input : [REP] [BEGIN] C N = [MASK] = O [END]
label : (C, 5)
ine-tuning
hts of the pre-trained Transformers (Section 2.2.4) are used to initialize the Molecule
mers in the proposed MT-DTI model (Figure 1). The output of the Transformers is
Methyl isocyanate (CN=C=O)
!44
Aug/26/2019
/50
Fine-tuning
• Protein uses CNN without pre-training - small number of proteins
!45
Aug/26/2019
/50
Evaluation Metrics
• C-Index

• probability of being correctly
ordered of two random samples

• MSE (mean square error)

• Metric used in QSAR[1]

• r^2 and r_0^2 are the squared
correlation coefficients with and
without intercept, respectively. 

• Acceptable model : value
greater than 0.5 

• AUPR - Area under the precision-
recall curve
Concordance Index (C-Index)
QSAR
!46
[1] Partha Pratim Roy, Somnath Paul, Indrani Mitra, and Kunal Roy. On two novel parameters for validation of predictive qsar models. Molecules, 14(5):1660–1701, 2009.
Aug/26/2019
/50
Result
• Five-fold CV

• MT-DTI outperforms all the other methods in all of the four metrics 

• MT-DTIw/oFT 

• Outperforms the similarity based metrics

• Performs better than Deep-DTA for some metrics.
!47
Aug/26/2019
/50
Case Study Design
• Goal: To find drugs (among FDA-approved drugs) targeting a
specific protein, epidermal growth factor receptor (EGFR) 

• FDA-approved drugs: 1794 molecules in the DrugBank
database

• EGFR: a well-known gene related to many cancer types 

• Method: infer scores between EGFR and the 1,794 selected
drugs and sort in descending order

• Expected result: Actual EGFR targeting drugs will be highly
ranked
!48
Aug/26/2019
/50
Case Study Result
• All existing EGFR
drugs (8 out of 1794
drugs) are listed in top
30

• KIBA scores>12.1
indicates it has
binding with the target

• Other non EGFR
drugs might possibly
be a new anti-cancer
drug candidate
!49
Aug/26/2019
/50
Discussion
• Summary

• Pre-train self-attention network with 97M molecules

• Fine-tune the self-attention network for DTI prediction

• Results

• A new SOTA of DTI

• Promising drug candidates targeting a specific protein

• Published to MLHC’19 (JMLR)

• Future direction

• Molecule generation
• Molecule optimization
!50

Mais conteúdo relacionado

Mais procurados

threading and homology modelling methods
threading and homology modelling methodsthreading and homology modelling methods
threading and homology modelling methodsmohammed muzammil
 
Chemo informatics scope and applications
Chemo informatics scope and applicationsChemo informatics scope and applications
Chemo informatics scope and applicationsshyam I
 
Cheminformatics
CheminformaticsCheminformatics
Cheminformaticsbaoilleach
 
Interaction fingerprint: 1D representation of 3D protein-ligand complexes
Interaction fingerprint: 1D representation of 3D protein-ligand complexesInteraction fingerprint: 1D representation of 3D protein-ligand complexes
Interaction fingerprint: 1D representation of 3D protein-ligand complexesVladimir Chupakhin
 
Cheminformatics in drug design
Cheminformatics in drug designCheminformatics in drug design
Cheminformatics in drug designSurmil Shah
 
HIGH THROUGHPUT SCREENING Technology
HIGH THROUGHPUT SCREENING  TechnologyHIGH THROUGHPUT SCREENING  Technology
HIGH THROUGHPUT SCREENING TechnologyUniversity Of Swabi
 
Pharmacophore mapping in Drug Development
Pharmacophore mapping in Drug DevelopmentPharmacophore mapping in Drug Development
Pharmacophore mapping in Drug DevelopmentMbachu Chinedu
 
Introduction to Bioinformatics
Introduction to BioinformaticsIntroduction to Bioinformatics
Introduction to BioinformaticsLeighton Pritchard
 
Lecture 8 drug targets and target identification
Lecture 8 drug targets and target identificationLecture 8 drug targets and target identification
Lecture 8 drug targets and target identificationRAJAN ROLTA
 
Computer aided-drug-design-boc sciences
Computer aided-drug-design-boc sciencesComputer aided-drug-design-boc sciences
Computer aided-drug-design-boc sciencesBOC-Sciences
 
Qsar and drug design ppt
Qsar and drug design pptQsar and drug design ppt
Qsar and drug design pptAbhik Seal
 
Role of bioinformatics in drug designing
Role of bioinformatics in drug designingRole of bioinformatics in drug designing
Role of bioinformatics in drug designingW Roseybala Devi
 
Needleman-wunch algorithm harshita
Needleman-wunch algorithm  harshitaNeedleman-wunch algorithm  harshita
Needleman-wunch algorithm harshitaHarshita Bhawsar
 
The Role of Bioinformatics in The Drug Discovery Process
The Role of Bioinformatics in The Drug Discovery ProcessThe Role of Bioinformatics in The Drug Discovery Process
The Role of Bioinformatics in The Drug Discovery ProcessAdebowale Qazeem
 

Mais procurados (20)

Data mining
Data miningData mining
Data mining
 
threading and homology modelling methods
threading and homology modelling methodsthreading and homology modelling methods
threading and homology modelling methods
 
Chemo informatics scope and applications
Chemo informatics scope and applicationsChemo informatics scope and applications
Chemo informatics scope and applications
 
Cheminformatics
CheminformaticsCheminformatics
Cheminformatics
 
Interaction fingerprint: 1D representation of 3D protein-ligand complexes
Interaction fingerprint: 1D representation of 3D protein-ligand complexesInteraction fingerprint: 1D representation of 3D protein-ligand complexes
Interaction fingerprint: 1D representation of 3D protein-ligand complexes
 
Cheminformatics in drug design
Cheminformatics in drug designCheminformatics in drug design
Cheminformatics in drug design
 
Protein structure prediction with a focus on Rosetta
Protein structure prediction with a focus on RosettaProtein structure prediction with a focus on Rosetta
Protein structure prediction with a focus on Rosetta
 
HIGH THROUGHPUT SCREENING Technology
HIGH THROUGHPUT SCREENING  TechnologyHIGH THROUGHPUT SCREENING  Technology
HIGH THROUGHPUT SCREENING Technology
 
Pharmacophore mapping in Drug Development
Pharmacophore mapping in Drug DevelopmentPharmacophore mapping in Drug Development
Pharmacophore mapping in Drug Development
 
Introduction to Bioinformatics
Introduction to BioinformaticsIntroduction to Bioinformatics
Introduction to Bioinformatics
 
Chemoinformatics.ppt
Chemoinformatics.pptChemoinformatics.ppt
Chemoinformatics.ppt
 
Bioinformatics and Drug Discovery
Bioinformatics and Drug DiscoveryBioinformatics and Drug Discovery
Bioinformatics and Drug Discovery
 
Lecture 8 drug targets and target identification
Lecture 8 drug targets and target identificationLecture 8 drug targets and target identification
Lecture 8 drug targets and target identification
 
ProCheck
ProCheckProCheck
ProCheck
 
Computer aided-drug-design-boc sciences
Computer aided-drug-design-boc sciencesComputer aided-drug-design-boc sciences
Computer aided-drug-design-boc sciences
 
Qsar and drug design ppt
Qsar and drug design pptQsar and drug design ppt
Qsar and drug design ppt
 
Role of bioinformatics in drug designing
Role of bioinformatics in drug designingRole of bioinformatics in drug designing
Role of bioinformatics in drug designing
 
Needleman-wunch algorithm harshita
Needleman-wunch algorithm  harshitaNeedleman-wunch algorithm  harshita
Needleman-wunch algorithm harshita
 
The Role of Bioinformatics in The Drug Discovery Process
The Role of Bioinformatics in The Drug Discovery ProcessThe Role of Bioinformatics in The Drug Discovery Process
The Role of Bioinformatics in The Drug Discovery Process
 
Homology Modelling
Homology ModellingHomology Modelling
Homology Modelling
 

Semelhante a Deep Learning Based Drug Discovery with Molecule Transformer

Using a keyword extraction pipeline to understand concepts in future work sec...
Using a keyword extraction pipeline to understand concepts in future work sec...Using a keyword extraction pipeline to understand concepts in future work sec...
Using a keyword extraction pipeline to understand concepts in future work sec...Kai Li
 
sa-mincut-aditya.ppt
sa-mincut-aditya.pptsa-mincut-aditya.ppt
sa-mincut-aditya.pptaashnareddy1
 
What will they need? Pre-assessment techniques for instruction session.
What will they need?  Pre-assessment techniques for instruction session.What will they need?  Pre-assessment techniques for instruction session.
What will they need? Pre-assessment techniques for instruction session.gwenexner
 
Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...
Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...
Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...Les Perelman
 
FLEAT VI - Harvard University - Piet Desmet & Bert Wylin
FLEAT VI - Harvard University - Piet Desmet & Bert WylinFLEAT VI - Harvard University - Piet Desmet & Bert Wylin
FLEAT VI - Harvard University - Piet Desmet & Bert WylinPiet Desmet
 
Data Science Course In Pune
Data Science Course In Pune Data Science Course In Pune
Data Science Course In Pune APT
 
data science institute in bangalore
data science institute in bangaloredata science institute in bangalore
data science institute in bangaloredevipatnala1
 
Data Science Course Pune
Data Science Course PuneData Science Course Pune
Data Science Course PuneAPT
 
Data science course pdf
Data science course pdfData science course pdf
Data science course pdfAPT
 
data science course in pune
data science course in punedata science course in pune
data science course in punedevipatnala1
 
data science certification
data science certificationdata science certification
data science certificationdevipatnala1
 
data science institute in bangalore
data science institute in bangaloredata science institute in bangalore
data science institute in bangaloredevipatnala1
 
Data Science course in Pune
Data Science course in PuneData Science course in Pune
Data Science course in Puneashvisingh
 

Semelhante a Deep Learning Based Drug Discovery with Molecule Transformer (20)

Using a keyword extraction pipeline to understand concepts in future work sec...
Using a keyword extraction pipeline to understand concepts in future work sec...Using a keyword extraction pipeline to understand concepts in future work sec...
Using a keyword extraction pipeline to understand concepts in future work sec...
 
sa-mincut-aditya.ppt
sa-mincut-aditya.pptsa-mincut-aditya.ppt
sa-mincut-aditya.ppt
 
sa.ppt
sa.pptsa.ppt
sa.ppt
 
What will they need? Pre-assessment techniques for instruction session.
What will they need?  Pre-assessment techniques for instruction session.What will they need?  Pre-assessment techniques for instruction session.
What will they need? Pre-assessment techniques for instruction session.
 
sa-mincut-aditya.ppt
sa-mincut-aditya.pptsa-mincut-aditya.ppt
sa-mincut-aditya.ppt
 
Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...
Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...
Artificial Unintelligence:Why and How Automated Essay Scoring Doesn’t Work (m...
 
Word 2 vector
Word 2 vectorWord 2 vector
Word 2 vector
 
FLEAT VI - Harvard University - Piet Desmet & Bert Wylin
FLEAT VI - Harvard University - Piet Desmet & Bert WylinFLEAT VI - Harvard University - Piet Desmet & Bert Wylin
FLEAT VI - Harvard University - Piet Desmet & Bert Wylin
 
Data Science Course In Pune
Data Science Course In Pune Data Science Course In Pune
Data Science Course In Pune
 
data science institute in bangalore
data science institute in bangaloredata science institute in bangalore
data science institute in bangalore
 
Data Science Course Pune
Data Science Course PuneData Science Course Pune
Data Science Course Pune
 
Data science course pdf
Data science course pdfData science course pdf
Data science course pdf
 
data science certification
data science certificationdata science certification
data science certification
 
data science course in pune
data science course in punedata science course in pune
data science course in pune
 
Data mining
Data miningData mining
Data mining
 
data science certification
data science certificationdata science certification
data science certification
 
data science institute in bangalore
data science institute in bangaloredata science institute in bangalore
data science institute in bangalore
 
Data science course in Pune
Data science course in PuneData science course in Pune
Data science course in Pune
 
Data Science course in Pune
Data Science course in PuneData Science course in Pune
Data Science course in Pune
 
Data science certification
Data science certificationData science certification
Data science certification
 

Mais de NAVER Engineering

디자인 시스템에 직방 ZUIX
디자인 시스템에 직방 ZUIX디자인 시스템에 직방 ZUIX
디자인 시스템에 직방 ZUIXNAVER Engineering
 
진화하는 디자인 시스템(걸음마 편)
진화하는 디자인 시스템(걸음마 편)진화하는 디자인 시스템(걸음마 편)
진화하는 디자인 시스템(걸음마 편)NAVER Engineering
 
서비스 운영을 위한 디자인시스템 프로젝트
서비스 운영을 위한 디자인시스템 프로젝트서비스 운영을 위한 디자인시스템 프로젝트
서비스 운영을 위한 디자인시스템 프로젝트NAVER Engineering
 
BPL(Banksalad Product Language) 무야호
BPL(Banksalad Product Language) 무야호BPL(Banksalad Product Language) 무야호
BPL(Banksalad Product Language) 무야호NAVER Engineering
 
이번 생에 디자인 시스템은 처음이라
이번 생에 디자인 시스템은 처음이라이번 생에 디자인 시스템은 처음이라
이번 생에 디자인 시스템은 처음이라NAVER Engineering
 
날고 있는 여러 비행기 넘나 들며 정비하기
날고 있는 여러 비행기 넘나 들며 정비하기날고 있는 여러 비행기 넘나 들며 정비하기
날고 있는 여러 비행기 넘나 들며 정비하기NAVER Engineering
 
쏘카프레임 구축 배경과 과정
 쏘카프레임 구축 배경과 과정 쏘카프레임 구축 배경과 과정
쏘카프레임 구축 배경과 과정NAVER Engineering
 
플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기
플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기
플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기NAVER Engineering
 
200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)
200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)
200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)NAVER Engineering
 
200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드
200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드
200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드NAVER Engineering
 
200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기
200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기
200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기NAVER Engineering
 
200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활
200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활
200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활NAVER Engineering
 
200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출
200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출
200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출NAVER Engineering
 
200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우
200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우
200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우NAVER Engineering
 
200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...
200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...
200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...NAVER Engineering
 
200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법
200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법
200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법NAVER Engineering
 
200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며
200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며
200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며NAVER Engineering
 
200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기
200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기
200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기NAVER Engineering
 
200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기
200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기
200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기NAVER Engineering
 

Mais de NAVER Engineering (20)

React vac pattern
React vac patternReact vac pattern
React vac pattern
 
디자인 시스템에 직방 ZUIX
디자인 시스템에 직방 ZUIX디자인 시스템에 직방 ZUIX
디자인 시스템에 직방 ZUIX
 
진화하는 디자인 시스템(걸음마 편)
진화하는 디자인 시스템(걸음마 편)진화하는 디자인 시스템(걸음마 편)
진화하는 디자인 시스템(걸음마 편)
 
서비스 운영을 위한 디자인시스템 프로젝트
서비스 운영을 위한 디자인시스템 프로젝트서비스 운영을 위한 디자인시스템 프로젝트
서비스 운영을 위한 디자인시스템 프로젝트
 
BPL(Banksalad Product Language) 무야호
BPL(Banksalad Product Language) 무야호BPL(Banksalad Product Language) 무야호
BPL(Banksalad Product Language) 무야호
 
이번 생에 디자인 시스템은 처음이라
이번 생에 디자인 시스템은 처음이라이번 생에 디자인 시스템은 처음이라
이번 생에 디자인 시스템은 처음이라
 
날고 있는 여러 비행기 넘나 들며 정비하기
날고 있는 여러 비행기 넘나 들며 정비하기날고 있는 여러 비행기 넘나 들며 정비하기
날고 있는 여러 비행기 넘나 들며 정비하기
 
쏘카프레임 구축 배경과 과정
 쏘카프레임 구축 배경과 과정 쏘카프레임 구축 배경과 과정
쏘카프레임 구축 배경과 과정
 
플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기
플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기
플랫폼 디자이너 없이 디자인 시스템을 구축하는 프로덕트 디자이너의 우당탕탕 고통 연대기
 
200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)
200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)
200820 NAVER TECH CONCERT 15_Code Review is Horse(코드리뷰는 말이야)(feat.Latte)
 
200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드
200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드
200819 NAVER TECH CONCERT 03_화려한 코루틴이 내 앱을 감싸네! 코루틴으로 작성해보는 깔끔한 비동기 코드
 
200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기
200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기
200819 NAVER TECH CONCERT 10_맥북에서도 아이맥프로에서 빌드하는 것처럼 빌드 속도 빠르게 하기
 
200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활
200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활
200819 NAVER TECH CONCERT 08_성능을 고민하는 슬기로운 개발자 생활
 
200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출
200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출
200819 NAVER TECH CONCERT 05_모르면 손해보는 Android 디버깅/분석 꿀팁 대방출
 
200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우
200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우
200819 NAVER TECH CONCERT 09_Case.xcodeproj - 좋은 동료로 거듭나기 위한 노하우
 
200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...
200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...
200820 NAVER TECH CONCERT 14_야 너두 할 수 있어. 비전공자, COBOL 개발자를 거쳐 네이버에서 FE 개발하게 된...
 
200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법
200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법
200820 NAVER TECH CONCERT 13_네이버에서 오픈 소스 개발을 통해 성장하는 방법
 
200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며
200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며
200820 NAVER TECH CONCERT 12_상반기 네이버 인턴을 돌아보며
 
200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기
200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기
200820 NAVER TECH CONCERT 11_빠르게 성장하는 슈퍼루키로 거듭나기
 
200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기
200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기
200819 NAVER TECH CONCERT 07_신입 iOS 개발자 개발업무 적응기
 

Último

"ML in Production",Oleksandr Bagan
"ML in Production",Oleksandr Bagan"ML in Production",Oleksandr Bagan
"ML in Production",Oleksandr BaganFwdays
 
Unleash Your Potential - Namagunga Girls Coding Club
Unleash Your Potential - Namagunga Girls Coding ClubUnleash Your Potential - Namagunga Girls Coding Club
Unleash Your Potential - Namagunga Girls Coding ClubKalema Edgar
 
Dev Dives: Streamline document processing with UiPath Studio Web
Dev Dives: Streamline document processing with UiPath Studio WebDev Dives: Streamline document processing with UiPath Studio Web
Dev Dives: Streamline document processing with UiPath Studio WebUiPathCommunity
 
Connect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck PresentationConnect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck PresentationSlibray Presentation
 
Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)
Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)
Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)Mark Simos
 
Leverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage Cost
Leverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage CostLeverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage Cost
Leverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage CostZilliz
 
"Debugging python applications inside k8s environment", Andrii Soldatenko
"Debugging python applications inside k8s environment", Andrii Soldatenko"Debugging python applications inside k8s environment", Andrii Soldatenko
"Debugging python applications inside k8s environment", Andrii SoldatenkoFwdays
 
Hyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdf
Hyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdfHyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdf
Hyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdfPrecisely
 
Anypoint Exchange: It’s Not Just a Repo!
Anypoint Exchange: It’s Not Just a Repo!Anypoint Exchange: It’s Not Just a Repo!
Anypoint Exchange: It’s Not Just a Repo!Manik S Magar
 
H2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo Day
H2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo DayH2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo Day
H2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo DaySri Ambati
 
How AI, OpenAI, and ChatGPT impact business and software.
How AI, OpenAI, and ChatGPT impact business and software.How AI, OpenAI, and ChatGPT impact business and software.
How AI, OpenAI, and ChatGPT impact business and software.Curtis Poe
 
Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024BookNet Canada
 
Take control of your SAP testing with UiPath Test Suite
Take control of your SAP testing with UiPath Test SuiteTake control of your SAP testing with UiPath Test Suite
Take control of your SAP testing with UiPath Test SuiteDianaGray10
 
The Ultimate Guide to Choosing WordPress Pros and Cons
The Ultimate Guide to Choosing WordPress Pros and ConsThe Ultimate Guide to Choosing WordPress Pros and Cons
The Ultimate Guide to Choosing WordPress Pros and ConsPixlogix Infotech
 
DSPy a system for AI to Write Prompts and Do Fine Tuning
DSPy a system for AI to Write Prompts and Do Fine TuningDSPy a system for AI to Write Prompts and Do Fine Tuning
DSPy a system for AI to Write Prompts and Do Fine TuningLars Bell
 
From Family Reminiscence to Scholarly Archive .
From Family Reminiscence to Scholarly Archive .From Family Reminiscence to Scholarly Archive .
From Family Reminiscence to Scholarly Archive .Alan Dix
 
"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack
"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack
"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek SchlawackFwdays
 
Ensuring Technical Readiness For Copilot in Microsoft 365
Ensuring Technical Readiness For Copilot in Microsoft 365Ensuring Technical Readiness For Copilot in Microsoft 365
Ensuring Technical Readiness For Copilot in Microsoft 3652toLead Limited
 
SIP trunking in Janus @ Kamailio World 2024
SIP trunking in Janus @ Kamailio World 2024SIP trunking in Janus @ Kamailio World 2024
SIP trunking in Janus @ Kamailio World 2024Lorenzo Miniero
 
Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024Scott Keck-Warren
 

Último (20)

"ML in Production",Oleksandr Bagan
"ML in Production",Oleksandr Bagan"ML in Production",Oleksandr Bagan
"ML in Production",Oleksandr Bagan
 
Unleash Your Potential - Namagunga Girls Coding Club
Unleash Your Potential - Namagunga Girls Coding ClubUnleash Your Potential - Namagunga Girls Coding Club
Unleash Your Potential - Namagunga Girls Coding Club
 
Dev Dives: Streamline document processing with UiPath Studio Web
Dev Dives: Streamline document processing with UiPath Studio WebDev Dives: Streamline document processing with UiPath Studio Web
Dev Dives: Streamline document processing with UiPath Studio Web
 
Connect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck PresentationConnect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck Presentation
 
Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)
Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)
Tampa BSides - Chef's Tour of Microsoft Security Adoption Framework (SAF)
 
Leverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage Cost
Leverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage CostLeverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage Cost
Leverage Zilliz Serverless - Up to 50X Saving for Your Vector Storage Cost
 
"Debugging python applications inside k8s environment", Andrii Soldatenko
"Debugging python applications inside k8s environment", Andrii Soldatenko"Debugging python applications inside k8s environment", Andrii Soldatenko
"Debugging python applications inside k8s environment", Andrii Soldatenko
 
Hyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdf
Hyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdfHyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdf
Hyperautomation and AI/ML: A Strategy for Digital Transformation Success.pdf
 
Anypoint Exchange: It’s Not Just a Repo!
Anypoint Exchange: It’s Not Just a Repo!Anypoint Exchange: It’s Not Just a Repo!
Anypoint Exchange: It’s Not Just a Repo!
 
H2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo Day
H2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo DayH2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo Day
H2O.ai CEO/Founder: Sri Ambati Keynote at Wells Fargo Day
 
How AI, OpenAI, and ChatGPT impact business and software.
How AI, OpenAI, and ChatGPT impact business and software.How AI, OpenAI, and ChatGPT impact business and software.
How AI, OpenAI, and ChatGPT impact business and software.
 
Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC CataList - Tech Forum 2024
 
Take control of your SAP testing with UiPath Test Suite
Take control of your SAP testing with UiPath Test SuiteTake control of your SAP testing with UiPath Test Suite
Take control of your SAP testing with UiPath Test Suite
 
The Ultimate Guide to Choosing WordPress Pros and Cons
The Ultimate Guide to Choosing WordPress Pros and ConsThe Ultimate Guide to Choosing WordPress Pros and Cons
The Ultimate Guide to Choosing WordPress Pros and Cons
 
DSPy a system for AI to Write Prompts and Do Fine Tuning
DSPy a system for AI to Write Prompts and Do Fine TuningDSPy a system for AI to Write Prompts and Do Fine Tuning
DSPy a system for AI to Write Prompts and Do Fine Tuning
 
From Family Reminiscence to Scholarly Archive .
From Family Reminiscence to Scholarly Archive .From Family Reminiscence to Scholarly Archive .
From Family Reminiscence to Scholarly Archive .
 
"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack
"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack
"Subclassing and Composition – A Pythonic Tour of Trade-Offs", Hynek Schlawack
 
Ensuring Technical Readiness For Copilot in Microsoft 365
Ensuring Technical Readiness For Copilot in Microsoft 365Ensuring Technical Readiness For Copilot in Microsoft 365
Ensuring Technical Readiness For Copilot in Microsoft 365
 
SIP trunking in Janus @ Kamailio World 2024
SIP trunking in Janus @ Kamailio World 2024SIP trunking in Janus @ Kamailio World 2024
SIP trunking in Janus @ Kamailio World 2024
 
Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024
 

Deep Learning Based Drug Discovery with Molecule Transformer

  • 1. Aug/26/2019 Deep Learning based Drug Discovery Bonggun Shin 1
  • 2. Aug/26/2019 /50 Outline • Problem definition • Drug discovery process • Drug target interaction (DTI) • Background • Sequence data in DTI • Recent trends in word embeddings • Previous SOTA in DTI • Molecule transformer !2
  • 3. Aug/26/2019 /50 Drug Discovery Process Target Identification Molecule Discovery Molecule Optimization Clinical Test FDA Approval Repurposing Generating • Green - Physical or computer based (in-silico) experiments • Yellow - Animal and human experiments !3
  • 4. Aug/26/2019 /50 Drug Repurposing • Safe - already approved drugs • Cheap - no need to come up with a new molecule Allarakhia, Minna. "Open-source approaches for the repurposing of existing or failed candidate drugs: learning from and applying the lessons across diseases." Drug design, development and therapy 7 (2013): 753 !4
  • 5. Aug/26/2019 /50 Drug Target Interaction • Input: • Drug - molecule • Target - protein (biomarker) • Output: Interaction (affinity score) • Example: EGFR protein (cancer biomarker) has high affinity scores with Lapatinib (anti-cancer drug) • If other non anti-cancer drugs has high affinity scores with EGFR, they can be candidates of an anti-cancer drug
 !5
  • 6. Aug/26/2019 /50 Inputs of DTI • Sequence • Molecule (SMILES format) • Lapatinib: "CS(=O)(=O)CCNCC1=CC=C(O1)C2…" • protein (FASTA format) • EGFR: "MRPSGTAGAALLALLAALCPASRALE…" !6
  • 7. Aug/26/2019 /50 Sequence Representation • Sequence: SMILES, FASTA, and text • Vector representation • One hot vector • (word/character) Embedding - more information • Once represented as a vector, we can apply many deep learning methods !7
  • 8. Aug/26/2019 /50 Recent trends in word embeddings • Local contextual embeddings: Word2vec [1] • RNN based contextual embeddings: ELMO [2] • Attention (w/o RNN) based contextual embeddings: Transformer [3] • The (current) final boss: BERT [4] 
 (Transformer+Masked LM) [1] Mikolov, Tomas, et al. "Distributed representations of words and phrases and their compositionality." NIPS 2013. [2] Peters, Matthew E., et al. "Deep contextualized word representations." NAACL (2018). [3] Vaswani, Ashish, et al. "Attention is all you need." Advances in Neural Information Processing Systems. 2017. [4] Devlin, Jacob, et al. "Bert: Pre-training of deep bidirectional transformers for language understanding." arXiv preprint arXiv:1810.04805 (2018).!8
  • 9. Aug/26/2019 /50 Word2Vec • Word representation: Word -> Vector • W2V: local context words when calculating a representation vector for a target word • EX) When inferring the red word, 4 context words (blues) are used !9
  • 10. Aug/26/2019 /50 Word2Vec • How to train word2vec • Example sentence: 
 I go to Emory University located in Atlanta. • input - context words • "I", "go", "Emory" "University" • output - target word, "to" !10
  • 11. Aug/26/2019 /50 ELMO • Concats of independently trained left-to-right and right- to- left LSTM • It considers all words in a sentence to represent a word • Long sequence -> information vanishing problem !11
  • 12. Aug/26/2019 /50 How to train ELMO • For the simplicity I assume word level embeddings (but actually they use character level embeddings) • How to train word2vec • Example sentence: 
 I go to Emory University located in Atlanta. • Input • left-to-right model: "I", "go" • right-to-left model: "Atlanta", "in" "located" "University", "Emory" • Output • "to" !12
  • 13. Aug/26/2019 /50 Transformer • Calculating a vector for a word using all words in the sentence • Attention is all you need! • replaces Embedding+RNN with the transformer (self-attention) !13
  • 14. Aug/26/2019 /50 Transformer • Model for machine translation • Trained (sub) model can be used as word representation model * All transformer figures in this slide are from http://jalammar.github.io/illustrated-transformer/ !14
  • 16. Aug/26/2019 /50 Encoder • Encoder can be stacked on top of each other (sequence length is preserved) • Input words are transformed into randomly initialized vectors, x_i • Encoder consists of two parts; self-attention and feed forward !16
  • 17. Aug/26/2019 /50 Self-Attention High level explanation • The vector for the token "it_" can be calculated as weighted sum (Attention) of all tokens in the same sentence (Self). !17
  • 18. Aug/26/2019 /50 Weighted Sum • Get three helper vectors • For a given token, calculate the scores of all other tokens • Normalize those scores to get weights • Weighted sum !18
  • 19. Aug/26/2019 /50 Three (Helper) Vectors • Query, Key, and Value vector are used when calculating hidden representations • These helper vectors are just a projection from trainable params Wq, Wk, and Wv !19
  • 20. Aug/26/2019 /50 Scoring • Calculate scores for each word with respect to token "Thinking" using (query, key) • For example: "Thinking": 112, "Machines: "96" • Repeat this for all other tokens • The vector, values, will be used in the next step !20
  • 21. Aug/26/2019 /50 Self-Attentions • Divide by 8 • The square root of the dimension of the key vectors (paper used dim=64) • Softmax: Normalize scores to be sum to one • Hidden representation is a weighted sum of value vectors !21
  • 22. Aug/26/2019 /50 Multi-Heads • Multi filters in CNN, Multi heads in Transformer • 8 Heads: 8 sets of trainable params Wq, Wk, and Wv, 8 sets of z1 and z2 • Expecting different heads to learn different aspects !22
  • 23. Aug/26/2019 /50 FeedForward This is the output of the one encoding layer (R) !23
  • 24. Aug/26/2019 /50 Positional Encoding • Why PE? - Need to distinguish "I am a student" vs "am student I a" • Special patterns representing order of words !24
  • 25. Aug/26/2019 /50 BERT • Google AI Language Team • 10 month ago • 1100+ citations • SOTA on eleven natural language processing tasks • Outperforms human on SQuaD task • Transformer + New language model task !25
  • 26. Aug/26/2019 /50 Overview • Based on the Transformers • Two new tasks • Modified input representation Transformer Transformer Transformer MaskedLM IsNext !26
  • 27. Aug/26/2019 /50 Input Representation • Segment Embedding (0:first sentence, 1:second sentence) • Position Embedding (same as Transformer) used for classification tasks sentence separator * Adopted from the BERT paper !27
  • 28. Aug/26/2019 /50 Masked LM Task • Given some "masked tokens" in a sentence, the task is to predict the original tokens • Original: I am a student • Input: I [MASK] a student, location (1) • Output: am • Downsides of this • [MASK] token is never seen during fine-tuning • 80% [MASK], 10% random token, 10% no change • 15% of [MASK] -> should be slow to learn a general language model • 4 days of TPU (v2-128) (worth of $10,000 google cloud credits) !28
  • 29. Aug/26/2019 /50 IsNext Task • Input consists of two sentences • Original: I am a student / I go to Emory • Input: [CLS] I [MASK] a student [SEP] I go [MASK] Emory [SEP], (masked token location, "2", "8") • Output of MaskedLM: 
 "am", "to" • Output of IsNext: 
 1 (2nd one is the next sentence of 1st one) !29
  • 30. Aug/26/2019 /50 Model Config • Base • Hidden-dim: 768 • A-Head: 12 • Layer: 12 • 110M parameters • Large • Hidden-dim: 1024 • A-Head: 16 • Layer: 24 • 340M parameters !30
  • 31. Aug/26/2019 /50 Finetuning (1/4) Sentence Pair Classification • MRPC • One sentence is a paraphrased one of the other • Task is to predict if given two sentences are semantically equivalent • X: ("I go to Emory", 
 "I am an Emory student") • Y: yes (equivalent) * From the BERT paper !31
  • 32. Aug/26/2019 /50 Finetuning (2/4) Single Sentence Classification • SST • Movie review • X: This movie is fun • Y: positive * From the BERT paper !32
  • 33. Aug/26/2019 /50 Finetuning (3/4) Question Answering • SQuAD • Given question and paragraph pairs, the task is to select a word/phrases that could answer the given question • X: (Q: "Where is Emory?", P: "Emory University is a private research university in the Druid Hills neighborhood of the city of Atlanta, Georgia, United States") • Y: (Druid, States) * From the BERT paper !33
  • 34. Aug/26/2019 /50 Finetuning (4/4) Single Sentence Tagging (NER) • Named Entity Recognition (NER) • Named entity? • Organization (Emory) • People (Bill Gates) • Location (Atlanta) … • Given a sentence the task is to tag each word if it indicates a certain named entity • X: "Dr. Xiong is a professor at Emory" • Y: B-PER I-PER O O O O B-ORG * From the BERT paper !34
  • 35. Aug/26/2019 /50 DeepDTA • DeepDTA: Deep drug target affinity • Previous SOTA in DTI • Bioinformatics (IF=5.481) • Task: predicting affinity scores • One-hot embedding+CNN+Dense Drug Vector Target Vector CNN Regression CNN FFNN !35
  • 40. Aug/26/2019 /50 Convolution Operation CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl 35 8 2XX X XX XXX X XX XX X XX XX X XX MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV…APQSSEFIGA YY Y YYY Y YY YY YY YY…YY Y YY Y YY Y Drug Vector Target Vector CNN Regression CNN FFNN !40
  • 41. Aug/26/2019 /50 Limitations of CNN • F and Cl will be convolved together: but they are actually in long distance • Cl will never be convolved with N: but they are closer than F • Local context (CNN) -> global context (self-attention) CS(=O)(=O)CCNCC1=CC=C(O1)C2=CC3=C(C=C2)N=CN=C3NC4=CC(=C(C=C4)OCC5=CC(=CC=C5)F)Cl !41
  • 42. Aug/26/2019 /50 Molecule Transformer • BERT based sequence representation • Pre-training: only masked LM • Special tokens - [CLS] [MASK] [SEP] vs [REP] [MASK] [BEGIN] [END] !42
  • 43. Aug/26/2019 /50 Special Tokens • [REP]: same as [CLS] • [BEGIN]/[END]: indicates truncation of long sequence (>100) • length<100: [REP] [BEGIN] C N = C = O [END] • length>100: [REP] C C = ( N == C) Cl … O = C !43
  • 44. Aug/26/2019 /50 Pre-train • PubChem database • 97,092,853 molecule • Parameters: layers 8, heads 8, and hidden vector size 128 • 8-core TPU machine, the pre-training took about 58 hours. • Masked LM task result: 0.9727 
 (BERT was 0.9855) MT-DTI We choose 15% of SMILES tokens at random for each molecule sequence, and he chosen token with one of the special tokens, [MASK] with the probability of 0.8. other 20% of the time, we replace the chosen token with a random SMILES token2 rve the chosen token, with an equal probability, respectively. The target label of is the chosen token with the index. For example, one possible prediction task for socyanate (CN=C=O) is input : [REP] [BEGIN] C N = [MASK] = O [END] label : (C, 5) ine-tuning hts of the pre-trained Transformers (Section 2.2.4) are used to initialize the Molecule mers in the proposed MT-DTI model (Figure 1). The output of the Transformers is Methyl isocyanate (CN=C=O) !44
  • 45. Aug/26/2019 /50 Fine-tuning • Protein uses CNN without pre-training - small number of proteins !45
  • 46. Aug/26/2019 /50 Evaluation Metrics • C-Index • probability of being correctly ordered of two random samples • MSE (mean square error) • Metric used in QSAR[1] • r^2 and r_0^2 are the squared correlation coefficients with and without intercept, respectively. • Acceptable model : value greater than 0.5 • AUPR - Area under the precision- recall curve Concordance Index (C-Index) QSAR !46 [1] Partha Pratim Roy, Somnath Paul, Indrani Mitra, and Kunal Roy. On two novel parameters for validation of predictive qsar models. Molecules, 14(5):1660–1701, 2009.
  • 47. Aug/26/2019 /50 Result • Five-fold CV • MT-DTI outperforms all the other methods in all of the four metrics • MT-DTIw/oFT • Outperforms the similarity based metrics • Performs better than Deep-DTA for some metrics. !47
  • 48. Aug/26/2019 /50 Case Study Design • Goal: To find drugs (among FDA-approved drugs) targeting a specific protein, epidermal growth factor receptor (EGFR) • FDA-approved drugs: 1794 molecules in the DrugBank database • EGFR: a well-known gene related to many cancer types • Method: infer scores between EGFR and the 1,794 selected drugs and sort in descending order • Expected result: Actual EGFR targeting drugs will be highly ranked !48
  • 49. Aug/26/2019 /50 Case Study Result • All existing EGFR drugs (8 out of 1794 drugs) are listed in top 30 • KIBA scores>12.1 indicates it has binding with the target • Other non EGFR drugs might possibly be a new anti-cancer drug candidate !49
  • 50. Aug/26/2019 /50 Discussion • Summary • Pre-train self-attention network with 97M molecules • Fine-tune the self-attention network for DTI prediction • Results • A new SOTA of DTI • Promising drug candidates targeting a specific protein • Published to MLHC’19 (JMLR) • Future direction • Molecule generation • Molecule optimization !50